PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009606735.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 588aa    MW: 65773.7 Da    PI: 8.6489
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009606735.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.57.4e-1957100448
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      WT+eEd ll ++vk++ g++Wk+Ia++m+ gRt+ qc +rwqk+l
   XP_009606735.1  57 WTEEEDNLLTEVVKRFKGRNWKKIAECMN-GRTDVQCLHRWQKVL 100
                      *****************************.************986 PP

2Myb_DNA-binding61.61.7e-19106152148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEd+l+v++v+++G + W+ Ia+ m+ gR +kqc++rw+++l
   XP_009606735.1 106 KGPWSKEEDDLIVELVEKYGCKKWSFIAKSMP-GRIGKQCRERWHNHL 152
                      79******************************.*************97 PP

3Myb_DNA-binding51.42.5e-16158200145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      r++WT++E+  l ++++ +G++ W+ Iar ++ gRt++ +k++w+
   XP_009606735.1 158 RDAWTEQEESVLCHYHQIYGNK-WAEIARFLP-GRTDNAIKNHWN 200
                      789*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.44347100IPR017930Myb domain
SMARTSM007176.6E-1553102IPR001005SANT/Myb domain
SuperFamilySSF466891.36E-1556110IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.8E-2456116IPR009057Homeodomain-like
CDDcd001671.47E-1457100No hitNo description
PfamPF002492.6E-1657100IPR001005SANT/Myb domain
PROSITE profilePS5129431.005101156IPR017930Myb domain
SuperFamilySSF466893.0E-32103199IPR009057Homeodomain-like
SMARTSM007173.7E-17105154IPR001005SANT/Myb domain
PfamPF002491.7E-18106152IPR001005SANT/Myb domain
CDDcd001673.13E-16108152No hitNo description
Gene3DG3DSA:1.10.10.601.2E-27117159IPR009057Homeodomain-like
PROSITE profilePS5129420.136157207IPR017930Myb domain
SMARTSM007175.8E-15157205IPR001005SANT/Myb domain
PfamPF002497.2E-14158201IPR001005SANT/Myb domain
CDDcd001674.24E-11160200No hitNo description
Gene3DG3DSA:1.10.10.603.7E-22160207IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 588 aa     Download sequence    Send to blast
MIQVKEESQT LDFGGFASCS SFSDSSYEAS TPRYSSEPGS SYRRSSGPTK RSSQAGWTEE  60
EDNLLTEVVK RFKGRNWKKI AECMNGRTDV QCLHRWQKVL NPELVKGPWS KEEDDLIVEL  120
VEKYGCKKWS FIAKSMPGRI GKQCRERWHN HLDPTIKRDA WTEQEESVLC HYHQIYGNKW  180
AEIARFLPGR TDNAIKNHWN SSVKKRLNLN LPSRLVLDTE SEGSPNFSSD KKKIEIKKHP  240
VQAQNAEQTI FLGKQTGLDN AAVALSTDLR IGYAYSAGNA LHKDTSLFGA CISAEENVRD  300
LIKPLGGIQF GKADVLPIGE TDKPCQSNLS RTKISYPLSA SSSDFPLDQL HHTSWSTSQV  360
EAVHPTTFRS MYESPKRSRH DTVNDPNCDF LSLSLASFTE VHSQSNKKNK AYDTQSSLGL  420
KQQGSLYYEP PQLKDMMIPL TDENLSRDDL IRQQNGHPFC STPPSLKLTV SANGSSPESV  480
LRNSAMSYTR TPSIIRKKNS RFPEAATHSR CTGTTSPTHI FPRASDREDT SNLKDRFSGC  540
KSSASGKSLG RRLEYAFDME WDASRCCTPV SAASPCALRL GGNTMLTP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-64572079159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-64572079159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1372377ESPKRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0561240.0AB056124.1 Nicotiana tabacum NtmybB mRNA for Myb, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009606734.10.0PREDICTED: uncharacterized protein LOC104101038
RefseqXP_009606735.10.0PREDICTED: uncharacterized protein LOC104101038
TrEMBLQ948S40.0Q948S4_TOBAC; Myb
STRINGPGSC0003DMT4000078990.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.22e-80myb domain protein 3r-5